Structure of PDB 4hot Chain A Binding Site BS01

Receptor Information
>4hot Chain A (length=476) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYN
LLAYVKHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYY
HMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKY
YQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSVKSFSLGPLR
KAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYA
AKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQIKKATH
NRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYS
NAEDIFRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALK
VKDRSPLRTKLTSALKKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAA
EYYEKAQKIDPENAEFLTALCELRLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hot Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		T37 Q41 K150 G153 Y156 R186 D189 R192 Y250 R253 Y254 K257 R260 F284 H287 Q288 L291 F337 F339 H374 Q377
Binding residue
(residue number reindexed from 1)		T32 Q36 K145 G148 Y151 R181 D184 R187 Y245 R248 Y249 K252 R255 F279 H282 Q283 L286 F332 F334 H369 Q372
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0000339 RNA cap binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0005515 protein binding
GO:0008266 poly(U) RNA binding
Biological Process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0051607 defense response to virus
GO:0051707 response to other organism
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0008385 IkappaB kinase complex
GO:0015629 actin cytoskeleton
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hot, PDBe:4hot, PDBj:4hot
PDBsum4hot
PubMed23334420
UniProtQ13325|IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 (Gene Name=IFIT5)

[Back to BioLiP]