Structure of PDB 4hn5 Chain A Binding Site BS01

Receptor Information
>4hn5 Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hn5 The structural basis of direct glucocorticoid-mediated transrepression.
Resolution1.902 Å
Binding residue
(original residue number in PDB)		C431 H432 Y433 K442 K446
Binding residue
(residue number reindexed from 1)		C13 H14 Y15 K24 K28
Binding affinityPDBbind-CN: Kd=363nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hn5, PDBe:4hn5, PDBj:4hn5
PDBsum4hn5
PubMed23222642
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]