Structure of PDB 4hj9 Chain A Binding Site BS01

Receptor Information
>4hj9 Chain A (length=139) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPY
TSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLG
YLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hj9 Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		K25 W27 Y28 Y36 F47 M49 T53 S55 R57 R68 W72 D73 K97 D99 H100 Y103 E105 H109
Binding residue
(residue number reindexed from 1)		K23 W25 Y26 Y34 F45 M47 T51 S53 R55 R66 W70 D71 K95 D97 H98 Y101 E103 H107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hj9, PDBe:4hj9, PDBj:4hj9
PDBsum4hj9
PubMed23201273
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]