Structure of PDB 4hj8 Chain A Binding Site BS01

Receptor Information
>4hj8 Chain A (length=138) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYT
SSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGY
LECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hj8 Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
Resolution2.043 Å
Binding residue
(original residue number in PDB)		K25 W27 Y28 Y36 F47 M49 S54 S55 R57 R68 I70 W72 D73 K97 D99 H100 L101 E105 H109
Binding residue
(residue number reindexed from 1)		K22 W24 Y25 Y33 F44 M46 S51 S52 R54 R65 I67 W69 D70 K94 D96 H97 L98 E102 H106
Binding affinityPDBbind-CN: Kd=22nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hj8, PDBe:4hj8, PDBj:4hj8
PDBsum4hj8
PubMed23201273
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]