Structure of PDB 4hha Chain A Binding Site BS01

Receptor Information
>4hha Chain A (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVLTQSPATLSLSPGERATISCRASQSVGGYLTWYQQKPGQAPRLLIYD
ASNRATGIPARFSGSGSGTDFTLTISGLEPEDFAIYYCQQRGNWPPITFG
QGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK
VDNALQSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS
SPVTKSFNRGEC
Ligand information
>4hha Chain P (length=10) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ETIYNTTLKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hha Structures of Preferred Human IgV Genes-Based Protective Antibodies Identify How Conserved Residues Contact Diverse Antigens and Assign Source of Specificity to CDR3 Loop Variation.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y32 Y49 R91 W94
Binding residue
(residue number reindexed from 1)		Y32 Y49 R91 W94
External links