Structure of PDB 4hh6 Chain A Binding Site BS01

Receptor Information
>4hh6 Chain A (length=157) Species: 216592 (Escherichia coli 042) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENSAALLRRLNHYCARALEGAASLCQTRAHAEITPEHWLLKLLEQGEGDL
TVLGRRYDWDMDAIWQSLLGWLDNQPRSVRSRPQLAQSLNALLKQAWMVA
SLQGEEHIRSVHLLGALTENPHLVRCDGLWPLLTLSQSQLQRLSPLLDAQ
SDECPET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hh6 Role and specificity of ClpV ATPases in T6SS secretion.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R13 L15 A20 L23 E24 R87 P88
Binding residue
(residue number reindexed from 1)
R8 L10 A15 L18 E19 R82 P83
Enzymatic activity
Enzyme Commision number ?
External links