Structure of PDB 4hcz Chain A Binding Site BS01

Receptor Information
>4hcz Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKD
ISPAALPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hcz Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
L38 W41 L46 Y47 F65 E66 D67 D68
Binding residue
(residue number reindexed from 1)
L11 W14 L19 Y20 F38 E39 D40 D41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4hcz, PDBe:4hcz, PDBj:4hcz
PDBsum4hcz
PubMed23142980
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]