Structure of PDB 4hca Chain A Binding Site BS01

Receptor Information
>4hca Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPTSCAN
CQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hca DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N286 A287 R299 R330 R331 K347 R365 N366 R367
Binding residue
(residue number reindexed from 1)		N27 A28 R40 R60 R61 K77 R95 N96 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hca, PDBe:4hca, PDBj:4hca
PDBsum4hca
PubMed23142663
UniProtP23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)

[Back to BioLiP]