Structure of PDB 4hc7 Chain A Binding Site BS01

Receptor Information
>4hc7 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRL
SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMK
KEGIQTRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hc7 DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R330 R331 R365 N366
Binding residue
(residue number reindexed from 1)		R72 R73 R107 N108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hc7, PDBe:4hc7, PDBj:4hc7
PDBsum4hc7
PubMed23142663
UniProtP23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)

[Back to BioLiP]