Structure of PDB 4h75 Chain A Binding Site BS01

Receptor Information
>4h75 Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGF
DCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETE
DGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMP
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h75 Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1.
Resolution2.098 Å
Binding residue
(original residue number in PDB)		D95 C96 Y98 F141 E142 W151 Y170 D173 Y177 Y179 Q180 D184 D189 H252
Binding residue
(residue number reindexed from 1)		D51 C52 Y54 F97 E98 W107 Y126 D129 Y133 Y135 Q136 D140 D145 H192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035064 methylated histone binding
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0007276 gamete generation
GO:0009303 rRNA transcription
GO:0016055 Wnt signaling pathway
GO:0030177 positive regulation of Wnt signaling pathway
GO:0045893 positive regulation of DNA-templated transcription
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005819 spindle
GO:0005829 cytosol
GO:0031965 nuclear membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h75, PDBe:4h75, PDBj:4h75
PDBsum4h75
PubMed23077255
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]