Structure of PDB 4h5o Chain A Binding Site BS01

Receptor Information
>4h5o Chain A (length=242) Species: 11588 (Rift Valley fever virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQELAIQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKD
AKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELT
LSRVAAALAGRTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMV
DPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAA
VNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
Ligand information
>4h5o Chain K (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h5o Phleboviruses encapsidate their genomes by sequestering RNA bases.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y30 F33 G65 N66 K67 R70 G95 N96 S105 R106 A109 V179 I180 N181 T195 F196 P199 A203
Binding residue
(residue number reindexed from 1)		Y27 F30 G62 N63 K64 R67 G92 N93 S102 R103 A106 V176 I177 N178 T192 F193 P196 A200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042802 identical protein binding
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044172 host cell endoplasmic reticulum-Golgi intermediate compartment
GO:0044177 host cell Golgi apparatus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4h5o, PDBe:4h5o, PDBj:4h5o
PDBsum4h5o
PubMed23129612
UniProtD3K5I7|NCAP_RVFV Nucleoprotein (Gene Name=N)

[Back to BioLiP]