Structure of PDB 4h5g Chain A Binding Site BS01

Receptor Information
>4h5g Chain A (length=240) Species: 637987 (Streptococcus pneumoniae str. Canada MDR_19A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSAVEAIKQKGKLVVATSPDYAPFEFQSLVDGKNQVVGADIDMAQAIADE
LGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYEN
KISFLVHKADVEKYKDLTSLESANIAAQKGTVPESMVKEQLPKAQLTSLT
NMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVATVSLKMKDGDANA
VALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEV
Ligand information
Ligand IDARG
InChIInChI=1S/C6H14N4O2/c7-4(5(11)12)2-1-3-10-6(8)9/h4H,1-3,7H2,(H,11,12)(H4,8,9,10)/p+1/t4-/m0/s1
InChIKeyODKSFYDXXFIFQN-BYPYZUCNSA-O
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0C(CC(C(=O)O)N)CNC(=[NH2+])N
CACTVS 3.341N[C@@H](CCCNC(N)=[NH2+])C(O)=O
OpenEye OEToolkits 1.5.0C(C[C@@H](C(=O)O)N)CNC(=[NH2+])N
CACTVS 3.341N[CH](CCCNC(N)=[NH2+])C(O)=O
ACDLabs 10.04O=C(O)C(N)CCCN\C(=[NH2+])N
FormulaC6 H15 N4 O2
NameARGININE
ChEMBL
DrugBank
ZINC
PDB chain4h5g Chain A Residue 310 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h5g Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 2
Resolution1.78 Å
Binding residue
(original residue number in PDB)		S47 D49 Y50 F91 A108 G109 I110 S111 R116 Q157 T160 D199
Binding residue
(residue number reindexed from 1)		S18 D20 Y21 F62 A79 G80 I81 S82 R87 Q128 T131 D170
Annotation score4
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 21:59:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4h5g', asym_id = 'A', bs = 'BS01', title = 'Crystal structure of an amino acid ABC transport...oniae Canada MDR_19A bound to L-arginine, form 2 '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4h5g', asym_id='A', bs='BS01', title='Crystal structure of an amino acid ABC transport...oniae Canada MDR_19A bound to L-arginine, form 2 ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0015276,0016020', uniprot = '', pdbid = '4h5g', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015276,0016020', uniprot='', pdbid='4h5g', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>