Structure of PDB 4h4f Chain A Binding Site BS01

Receptor Information
>4h4f Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNT
RTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAE
HVELSDTIQVACLPEKDSLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQP
VVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGPLNCQLENGSW
EVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h4f Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R23 S26 W27 W29 D116 V120 C122 Y137 S206 W207
Binding residue
(residue number reindexed from 1)		R8 S11 W12 W14 D106 V110 C112 Y127 S199 W200
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 N192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H45 D92 N184 G185 D186 S187 G188
Enzyme Commision number 3.4.21.2: chymotrypsin C.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0006874 intracellular calcium ion homeostasis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4h4f, PDBe:4h4f, PDBj:4h4f
PDBsum4h4f
PubMed23430245
UniProtQ99895|CTRC_HUMAN Chymotrypsin-C (Gene Name=CTRC)

[Back to BioLiP]