Structure of PDB 4h44 Chain A Binding Site BS01

Receptor Information

>4h44 Chain A (length=215) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

MANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFAT
GFAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILH
VFRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKI
VSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFML
FHFLMIRKQGISGPL

Ligand information

>4h44 Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

MAILTLGWVSLLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4h44 Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): N31 I32
• Binding residue (residue number reindexed from 1): N31 I32

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R207 I211

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4h44, PDBe:4h44, PDBj:4h44
• PDBsum: 4h44
• PubMed: 23440205
• UniProt: P0A384|CYB6_NOSS1 Cytochrome b6 (Gene Name=petB)