Structure of PDB 4h10 Chain A Binding Site BS01

Receptor Information
>4h10 Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMA
VQHMKTLRGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h10 Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA.
Resolution2.402 Å
Binding residue
(original residue number in PDB)		H77 S78 E81 R85 D110 K111
Binding residue
(residue number reindexed from 1)		H9 S10 E13 R17 D42 K43
Binding affinityPDBbind-CN: Kd=1.52uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h10, PDBe:4h10, PDBj:4h10
PDBsum4h10
PubMed23229515
UniProtO00327|BMAL1_HUMAN Basic helix-loop-helix ARNT-like protein 1 (Gene Name=BMAL1)

[Back to BioLiP]