Structure of PDB 4gxb Chain A Binding Site BS01

Receptor Information

>4gxb Chain A (length=263) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFS
LFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYD
DDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLR
LAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRM
RCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSIC
LQSMVDELMVKKS

Ligand information

>4gxb Chain B (length=15) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GTYGVFTNAAYDPTP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gxb Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	T316 R317 M318 R319 C320 W321 R322 V323 L353 I370 M384
Binding residue (residue number reindexed from 1)	T198 R199 M200 R201 C202 W203 R204 V205 L228 I245 M259

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0035091	phosphatidylinositol binding

	Biological Process
GO:0006886	intracellular protein transport
GO:0007165	signal transduction

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4gxb, PDBe:4gxb, PDBj:4gxb
PDBsum	4gxb
PubMed	23382219
UniProt	Q15036\|SNX17_HUMAN Sorting nexin-17 (Gene Name=SNX17)

[Back to BioLiP]