Structure of PDB 4gvd Chain A Binding Site BS01

Receptor Information
>4gvd Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGKVTHSIHIEKADTYGFSLSSVEEIRRLYVNSVKETGLASKKGLKAG
DEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gvd The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		T843 H844 S845
Binding residue
(residue number reindexed from 1)		T7 H8 S9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
Biological Process
GO:0007264 small GTPase-mediated signal transduction
GO:0090630 activation of GTPase activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4gvd, PDBe:4gvd, PDBj:4gvd
PDBsum4gvd
PubMed23395182
UniProtQ13009|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]