Structure of PDB 4gvc Chain A Binding Site BS01

Receptor Information

>4gvc Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASK
KGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL

Ligand information

>4gvc Chain B (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TKQEEFYA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gvc The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
Resolution	1.54 Å
Binding residue (original residue number in PDB)	T857 Y858 G859 F860 S861 L862 S863 S864 N876 K879 L915
Binding residue (residue number reindexed from 1)	T21 Y22 G23 F24 S25 L26 S27 S28 N40 K43 L79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005085	guanyl-nucleotide exchange factor activity

	Biological Process
GO:0007264	small GTPase-mediated signal transduction
GO:0090630	activation of GTPase activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4gvc, PDBe:4gvc, PDBj:4gvc
PDBsum	4gvc
PubMed	23395182
UniProt	Q13009\|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]