Structure of PDB 4gv9 Chain A Binding Site BS01

Receptor Information
>4gv9 Chain A (length=198) Species: 11622 (Lassa virus Josiah) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIH
FFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQ
GSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGV
VVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRPRVVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gv9 Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
Resolution2.46 Å
Binding residue
(original residue number in PDB)
D389 E391 G392 R393 D426 S430 D466 K488 H528
Binding residue
(residue number reindexed from 1)
D27 E29 G30 R31 D64 S68 D104 K126 H160
Enzymatic activity
Enzyme Commision number 3.1.13.-
External links
PDB RCSB:4gv9, PDBe:4gv9, PDBj:4gv9
PDBsum4gv9
PubMed23615902
UniProtP13699|NCAP_LASSJ Nucleoprotein (Gene Name=N)

[Back to BioLiP]