Structure of PDB 4gnt Chain A Binding Site BS01

Receptor Information
>4gnt Chain A (length=231) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYK
NVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLE
LLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAY
QEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEA
IAELDTLNEESYKDSTLIMQLLRDNLTLWTS
Ligand information
>4gnt Chain B (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKIRLNNAIWRAWYIQYVQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gnt Crystal Structure of Carbohydrate Response Element Binding Protein (ChREBP) in complex with 14-3-3b
Resolution2.41 Å
Binding residue
(original residue number in PDB)		R58 S59 R62 S66 Y181 E182 T217 L218 Q221 D225 L229
Binding residue
(residue number reindexed from 1)		R57 S58 R61 S65 Y180 E181 T216 L217 Q220 D224 L228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0043085 positive regulation of catalytic activity
GO:0045184 establishment of protein localization
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gnt, PDBe:4gnt, PDBj:4gnt
PDBsum4gnt
PubMed
UniProtQ9CQV8|1433B_MOUSE 14-3-3 protein beta/alpha (Gene Name=Ywhab)

[Back to BioLiP]