Structure of PDB 4gne Chain A Binding Site BS01

Receptor Information
>4gne Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWH
QCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gne The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.
Resolution1.47 Å
Binding residue
(original residue number in PDB)		E1321 D1322 G1330 G1331 E1332 L1333 V1334 M1335 P1356 G1358
Binding residue
(residue number reindexed from 1)		E6 D7 G15 G16 E17 L18 V19 M20 P41 G43
Enzymatic activity
Enzyme Commision number 2.1.1.370: [histone H3]-lysine(4) N-dimethyltransferase.
2.1.1.371: [histone H3]-lysine(27) N-dimethyltransferase.
External links
PDB RCSB:4gne, PDBe:4gne, PDBj:4gne
PDBsum4gne
PubMed23269674
UniProtQ9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 (Gene Name=NSD3)

[Back to BioLiP]