Structure of PDB 4ghu Chain A Binding Site BS01

Receptor Information
>4ghu Chain A (length=190) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYK
RRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTG
EMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ghu Single Amino Acid Substitutions Confer the Antiviral Activity of the TRAF3 Adaptor Protein onto TRAF5
Resolution2.199 Å
Binding residue
(original residue number in PDB)		R456 Y458 D462 F473 D509 E526 M527 I529 A530 S531 G532 C533 P534 F536
Binding residue
(residue number reindexed from 1)		R81 Y83 D87 F98 D134 E151 M152 I154 A155 S156 G157 C158 P159 F161
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0001817 regulation of cytokine production
GO:0008063 Toll signaling pathway
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0045087 innate immune response
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ghu, PDBe:4ghu, PDBj:4ghu
PDBsum4ghu
PubMed23150880
UniProtQ60803|TRAF3_MOUSE TNF receptor-associated factor 3 (Gene Name=Traf3)

[Back to BioLiP]