Structure of PDB 4ggn Chain A Binding Site BS01

Receptor Information
>4ggn Chain A (length=125) Species: 5851 (Plasmodium knowlesi strain H) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDMFNTKSSKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLE
YLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQE
ANDALNAFSSEDRINYKLFCEDILS
Ligand information
>4ggn Chain D (length=15) Species: 73239 (Plasmodium yoelii yoelii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLMRVQAHIRKRMVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ggn The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		H98 R101 K102 L105 A106 P107 H137 D140 L145 I168 L169 W172 G173 D174 A175 L176 E180 D202 I203 L204 S205
Binding residue
(residue number reindexed from 1)		H18 R21 K22 L25 A26 P27 H57 D60 L65 I88 L89 W92 G93 D94 A95 L96 E100 D122 I123 L124 S125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:4ggn, PDBe:4ggn, PDBj:4ggn
PDBsum4ggn
PubMed23831371
UniProtA0A384KCF1

[Back to BioLiP]