Structure of PDB 4g92 Chain A Binding Site BS01

Receptor Information
>4g92 Chain A (length=61) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRP
RGPGGRFLTAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g92 DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y268 L269 H270 R273 H274 M278 R282 P284 G285 G286 F288
Binding residue
(residue number reindexed from 1)		Y37 L38 H39 R42 H43 M47 R51 P53 G54 G55 F57
Binding affinityPDBbind-CN: Kd=3.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4g92, PDBe:4g92, PDBj:4g92
PDBsum4g92
PubMed22902862
UniProtP87249

[Back to BioLiP]