Structure of PDB 4g69 Chain A Binding Site BS01

Receptor Information
>4g69 Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAA
HKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g69 Structure of the Human Discs Large 1 PDZ2- Adenomatous Polyposis Coli Cytoskeletal Polarity Complex: Insight into Peptide Engagement and PDZ Clustering.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		L329 F331 S332 I333 N339 H384
Binding residue
(residue number reindexed from 1)		L20 F22 S23 I24 N30 H75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4g69, PDBe:4g69, PDBj:4g69
PDBsum4g69
PubMed23185543
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]