Structure of PDB 4g35 Chain A Binding Site BS01

Receptor Information
>4g35 Chain A (length=129) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDDLYRQSLEIISRYLREQATGRRALETLRRVGDGVQRNHETAFQGMLRK
KSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAET
ITDVLVRTKRDWLVKQRGWDGFVEFFHVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g35 Rational design of proteolytically stable, cell-permeable peptide-based selective Mcl-1 inhibitors.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H224 M231 V249 H252 V253 N260 G262 R263 T266 F318 F319 V321
Binding residue
(residue number reindexed from 1)		H40 M47 V56 H59 V60 N67 G69 R70 T73 F125 F126 V128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4g35, PDBe:4g35, PDBj:4g35
PDBsum4g35
PubMed22920569
UniProtP97287|MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Gene Name=Mcl1)

[Back to BioLiP]