Structure of PDB 4fzz Chain A Binding Site BS01

Receptor Information
>4fzz Chain A (length=166) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAI
HRITEAMVADKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTM
KLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDI
MNTSGWTAEQMADITG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fzz Recognition and processing of double-stranded DNA by ExoX, a distributive 3'-5' exonuclease
Resolution2.8 Å
Binding residue
(original residue number in PDB)		L12 Q13 K101
Binding residue
(residue number reindexed from 1)		L12 Q13 K101
Enzymatic activity
Enzyme Commision number 3.1.11.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4fzz, PDBe:4fzz, PDBj:4fzz
PDBsum4fzz
PubMed23771145
UniProtP0AEK0|EXOX_ECOLI Exodeoxyribonuclease 10 (Gene Name=exoX)

[Back to BioLiP]