Structure of PDB 4fzy Chain A Binding Site BS01

Receptor Information
>4fzy Chain A (length=167) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAI
HRITEAMVADKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTM
KLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDI
MNTSGWTAEQMADITGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fzy Recognition and processing of double-stranded DNA by ExoX, a distributive 3'-5' exonuclease
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E8 T9 L12 I50 N81 F84 M100 Y112 S113 H134
Binding residue
(residue number reindexed from 1)		E8 T9 L12 I50 N81 F84 M100 Y112 S113 H134
Enzymatic activity
Enzyme Commision number 3.1.11.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4fzy, PDBe:4fzy, PDBj:4fzy
PDBsum4fzy
PubMed23771145
UniProtP0AEK0|EXOX_ECOLI Exodeoxyribonuclease 10 (Gene Name=exoX)

[Back to BioLiP]