Structure of PDB 4fzd Chain A Binding Site BS01

Receptor Information
>4fzd Chain A (length=321) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPADIVKNLKESMAVLEKQSDKKAEKATEEVSKNLVAMKEILYGTNEKEP
QTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGT
RTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILW
SEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFS
EYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNL
LRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQND
RTEDEQFNDEKTYLVKQIRDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fzd Structure of the MST4 in Complex with MO25 Provides Insights into Its Activation Mechanism
Resolution3.25 Å
Binding residue
(original residue number in PDB)		K257 M260 N261 R264 N298 L302 F305
Binding residue
(residue number reindexed from 1)		K245 M248 N249 R252 N286 L290 F293
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019900 kinase binding
GO:0030295 protein kinase activator activity
GO:0043539 protein serine/threonine kinase activator activity
Biological Process
GO:0007165 signal transduction
GO:0010800 positive regulation of peptidyl-threonine phosphorylation
GO:0014823 response to activity
GO:0018105 peptidyl-serine phosphorylation
GO:0035556 intracellular signal transduction
GO:0071476 cellular hypotonic response
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0097066 response to thyroid hormone
GO:1901017 negative regulation of potassium ion transmembrane transporter activity
GO:1901380 negative regulation of potassium ion transmembrane transport
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030018 Z disc
GO:0032991 protein-containing complex
GO:0034774 secretory granule lumen
GO:0070062 extracellular exosome
GO:1902554 serine/threonine protein kinase complex
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fzd, PDBe:4fzd, PDBj:4fzd
PDBsum4fzd
PubMed23434407
UniProtQ9Y376|CAB39_HUMAN Calcium-binding protein 39 (Gene Name=CAB39)

[Back to BioLiP]