Structure of PDB 4fqx Chain A Binding Site BS01

Receptor Information

>4fqx Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRF
ASFEAQGALANIACDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELRE
PNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYL
PFLPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>4fqx Chain E (length=7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NCLKLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4fqx Crystal Structure of the HLA-DM-HLA-DR1 Complex Defines Mechanisms for Rapid Peptide Selection.
Resolution	2.599 Å
Binding residue (original residue number in PDB)	C65 N69
Binding residue (residue number reindexed from 1)	C64 N68

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4fqx, PDBe:4fqx, PDBj:4fqx
PDBsum	4fqx
PubMed	23260142
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]