Structure of PDB 4fmn Chain A Binding Site BS01

Receptor Information
>4fmn Chain A (length=265) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERVNVNLTSIKKLREKVDDSIHRELTDIFANLNYVGVVDEERRLAAIQHD
LKLFLIDYGSVCYELFYQIGLTDFANFGKINLQSTNVSDDIVLYNLLSEF
DELNDDASKEKIISKIWDMSSMLNEYYSIELVNDGLDNDLKSVKLKSLPL
LLKGYIPSLVKLPFFIYRLGKEVDWEDEQECLDGILREIALLYIPDMVPK
VDTSDASLSEDEKAQFINRKEHISSLLEHVLFPCIKRRFLAPRHILKDVV
EIANLPDLYKVFERC
Ligand information
>4fmn Chain C (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VRSKYFK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fmn Structure of the MutL alpha C-terminal domain reveals how Mlh1 contributes to Pms1 endonuclease site.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		N510 L511 T512 M626 E629 Y630 E682 C685
Binding residue
(residue number reindexed from 1)		N6 L7 T8 M122 E125 Y126 E178 C181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006298 mismatch repair
Cellular Component
GO:0032300 mismatch repair complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fmn, PDBe:4fmn, PDBj:4fmn
PDBsum4fmn
PubMed23435383
UniProtP38920|MLH1_YEAST DNA mismatch repair protein MLH1 (Gene Name=MLH1)

[Back to BioLiP]