Structure of PDB 4fjo Chain A Binding Site BS01

Receptor Information
>4fjo Chain A (length=97) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLE
KLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fjo Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric Pol zeta and Pol kappa
Resolution2.718 Å
Binding residue
(original residue number in PDB)		L1157 A1158 G1159 L1169 E1172 W1173 D1184 Q1187 V1188
Binding residue
(residue number reindexed from 1)		L5 A6 G7 L17 E20 W21 D32 Q35 V36
Enzymatic activity
Enzyme Commision number 2.7.7.-
External links
PDB RCSB:4fjo, PDBe:4fjo, PDBj:4fjo
PDBsum4fjo
PubMed22859295
UniProtQ920Q2|REV1_MOUSE DNA repair protein REV1 (Gene Name=Rev1)

[Back to BioLiP]