Structure of PDB 4fgn Chain A Binding Site BS01

Receptor Information
>4fgn Chain A (length=126) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVT
FISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLM
YSALTRDPFSVIEESLPGGLKEHDFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fgn Analysis of the Costructure of the Simian Virus 40 T-Antigen Origin Binding Domain with Site I Reveals a Correlation between GAGGC Spacing and Spiral Assembly.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N153 T155 R202 H203 R204 A207 N210
Binding residue
(residue number reindexed from 1)		N21 T23 R70 H71 R72 A75 N78
Binding affinityPDBbind-CN: Kd~12.3nM
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4fgn, PDBe:4fgn, PDBj:4fgn
PDBsum4fgn
PubMed23269808
UniProtP03070|LT_SV40 Large T antigen

[Back to BioLiP]