Structure of PDB 4fc8 Chain A Binding Site BS01

Receptor Information

>4fc8 Chain A (length=133) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

MATIEEIKEVVLKPYTNHRQLTIREVETISINLIDLLITKDVKDARTMKY
ISRFLTKQDYADLVQERNLVKRCGYPLCSKSQARVAYLTEYCTKAHFRCS
QFYQFQLSDEALFARVGVHLDDYEPPSEIQLLE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4fc8 Chain A Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4fc8 The yeast regulator of transcription protein Rtr1 lacks an active site and phosphatase activity.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): C73 C78 C111 H115
• Binding residue (residue number reindexed from 1): C73 C78 C92 H96
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Gene Ontology

Molecular Function

• GO:0004721 phosphoprotein phosphatase activity
• GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity
• GO:0017018 myosin phosphatase activity
• GO:0043175 RNA polymerase core enzyme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:4fc8, PDBe:4fc8, PDBj:4fc8
• PDBsum: 4fc8
• PubMed: 22781759
• UniProt: Q6CK86