Structure of PDB 4fbw Chain A Binding Site BS01

Receptor Information

>4fbw Chain A (length=379) Species: 284812 (Schizosaccharomyces pombe 972h-)

NENTIRILISSDPHVGYGEKDPVRGNDSFVSFNEILEIARERDVDMILLG
GDIFHDNKPSRKALYQALRSLRLNCLGDKPCELELLSNINYLDPNINVAI
PVFSIHGNHDDRYSALDILQVTGLVNYFGRVPNIVVSPILLQKGFTKLAL
YGISNVRDERLYHSFRENKVKFLRPDLYRDEWFNLLTVHQNHSAHTPTSY
LPESFIQDFYDFVLWGHEHECLIDGSYNPTQKFTVVQPGSTIATSLSPGE
TAPKHCGILNITGKDFHLEKIRLRTVRPFIMKDIILSEVSSIPPMVENKK
EVLTYLISKVEEAITEANAQWYEAQGTVPVVENEKPPLPLIRLRVDYTGG
YQTENPQRFSNRFVGRVANATDVVQFYLK

Ligand information

>4fbw Chain C (length=21) Species: 284812 (Schizosaccharomyces pombe 972h-)

NRRLRNLGSVEYIRNFKKFQK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4fbw Structure of Mre11-Nbs1 complex yields insights into ataxia-telangiectasia-like disease mutations and DNA damage signaling.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): K92 P93 C94 E95 L96 E97 Y116 L117 P119 N120 I121 N122 V123 Y195 F198 N201 V203 K204 F205 L206 R207 P208 D209 R212 Y233 S237 F238 Q240 D241 F242 Q264
• Binding residue (residue number reindexed from 1): K79 P80 C81 E82 L83 E84 Y91 L92 P94 N95 I96 N97 V98 Y162 F165 N168 V170 K171 F172 L173 R174 P175 D176 R179 Y200 S204 F205 Q207 D208 F209 Q231

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0008296 3'-5'-DNA exonuclease activity
• GO:0016787 hydrolase activity
• GO:0030145 manganese ion binding

Biological Process

• GO:0006302 double-strand break repair

Cellular Component

• GO:0005634 nucleus
• GO:0030870 Mre11 complex

External links

• PDB: RCSB:4fbw, PDBe:4fbw, PDBj:4fbw
• PDBsum: 4fbw
• PubMed: 22705791
• UniProt: Q09683|RAD32_SCHPO Double-strand break repair protein rad32 (Gene Name=rad32)