Structure of PDB 4f6n Chain A Binding Site BS01

Receptor Information
>4f6n Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f6n Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R501 Y503 V504 S508 R511 E535 Y536 Q563 Y597 A598
Binding residue
(residue number reindexed from 1)
R21 Y23 V24 S28 R31 E55 Y56 Q83 Y117 A118
Binding affinityPDBbind-CN: Kd=190pM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4f6n, PDBe:4f6n, PDBj:4f6n
PDBsum4f6n
PubMed22949637
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]