Structure of PDB 4ezw Chain A Binding Site BS01

Receptor Information

>4ezw Chain A (length=214) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIA

Ligand information

>4ezw Chain E (length=7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NRLLLTG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ezw Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	T403 V425 F426 S427 T428 A429 Q433 V436 T437
Binding residue (residue number reindexed from 1)	T15 V37 F38 S39 T40 A41 Q45 V48 T49

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:4ezw, PDBe:4ezw, PDBj:4ezw
PDBsum	4ezw
PubMed	23562829
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]