Structure of PDB 4ezu Chain A Binding Site BS01

Receptor Information
>4ezu Chain A (length=216) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ezu Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
Resolution1.9 Å
Binding residue
(original residue number in PDB)
T403 M404 F426 S427 A429 E430 D431 N432 Q433 V436 T437 G468 M469 Q471
Binding residue
(residue number reindexed from 1)
T15 M16 F38 S39 A41 E42 D43 N44 Q45 V48 T49 G80 M81 Q83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4ezu, PDBe:4ezu, PDBj:4ezu
PDBsum4ezu
PubMed
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]