Structure of PDB 4ezs Chain A Binding Site BS01

Receptor Information
>4ezs Chain A (length=218) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQQQH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ezs Structural studies of DnaK in complex with proline rich antimicrobial peptides reveal two different peptide binding modes
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E402 T403 M404 G405 G406 F426 S427 Q433 A435 V436 T437 R467 G468 H541
Binding residue
(residue number reindexed from 1)		E14 T15 M16 G17 G18 F38 S39 Q45 A47 V48 T49 R79 G80 H153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4ezs, PDBe:4ezs, PDBj:4ezs
PDBsum4ezs
PubMed
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]