Structure of PDB 4ezn Chain A Binding Site BS01

Receptor Information

>4ezn Chain A (length=211) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLM

Ligand information

>4ezn Chain C (length=6) Species: 37000 (Pyrrhocoris apterus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SYLPRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ezn Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	T403 M404 G405 F426 S427 T428 A429 Q433 V436 R467
Binding residue (residue number reindexed from 1)	T15 M16 G17 F38 S39 T40 A41 Q45 V48 R79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:4ezn, PDBe:4ezn, PDBj:4ezn
PDBsum	4ezn
PubMed	23562829
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]