Structure of PDB 4ew0 Chain A Binding Site BS01

Receptor Information
>4ew0 Chain A (length=143) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPS
AEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGI
GKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ew0 Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		R442 K478 L480 G481 L482 Y483 D484 L485
Binding residue
(residue number reindexed from 1)		R31 K67 L69 G70 L71 Y72 D73 L74
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ew0, PDBe:4ew0, PDBj:4ew0
PDBsum4ew0
PubMed22740654
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]