Structure of PDB 4euw Chain A Binding Site BS01

Receptor Information
>4euw Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKR
PFVEEAERLRVQHKKDHPDYKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4euw Crystal structure of a HMG domain of transcription factor SOX-9 bound to DNA (SOX-9/DNA) from Homo sapiens at 2.77 A resolution
Resolution2.77 Å
Binding residue
(original residue number in PDB)		N110 F112 M113 A133 S136 W143 R162 Y174
Binding residue
(residue number reindexed from 1)		N8 F10 M11 A31 S34 W41 R60 Y72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4euw, PDBe:4euw, PDBj:4euw
PDBsum4euw
PubMed
UniProtP48436|SOX9_HUMAN Transcription factor SOX-9 (Gene Name=SOX9)

[Back to BioLiP]