Structure of PDB 4esj Chain A Binding Site BS01

Receptor Information

>4esj Chain A (length=246) Species: 170187 (Streptococcus pneumoniae TIGR4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PHMELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFPVA
DFYCNHCSEEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYT
KNFEVNNFLVLPKQFVTPKSIIQRKPLAGWIGCNIDLSQVPSKGRIFLVQ
DGQVRDPEKVTKEFKQGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLED
MYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRKL

Ligand information

>4esj Chain C (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctggatccag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4esj Crystal structure and mechanism of action of the N6-methyladenine-dependent type IIM restriction endonuclease R.DpnI.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	L206 R231 Q232 Q235 R238 F245 G249 Y251
Binding residue (residue number reindexed from 1)	L198 R223 Q224 Q227 R230 F237 G241 Y243

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4esj, PDBe:4esj, PDBj:4esj
PDBsum	4esj
PubMed	22610857
UniProt	P0A460\|T2D1_STRR6 Type II Methyl-directed restriction enzyme DpnI (Gene Name=dpnC)

[Back to BioLiP]