Structure of PDB 4erd Chain A Binding Site BS01

Receptor Information
>4erd Chain A (length=108) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRL
AIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKF
FFMKKQQK
Ligand information
>4erd Chain C (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucgacaucuucggauggacc
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4erd Structural Basis for Telomerase RNA Recognition and RNP Assembly by the Holoenzyme La Family Protein p65.
Resolution2.589 Å
Binding residue
(original residue number in PDB)		F525 K528
Binding residue
(residue number reindexed from 1)		F101 K104
Binding affinityPDBbind-CN: Kd=101nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4erd, PDBe:4erd, PDBj:4erd
PDBsum4erd
PubMed22705372
UniProtW7X6T2|LARP7_TETTS La-related protein 7 homolog (Gene Name=TAP65)

[Back to BioLiP]