Structure of PDB 4erc Chain A Binding Site BS01

Receptor Information

>4erc Chain A (length=150) Species: 9606 (Homo sapiens)

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHS
DSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFG
RTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK

Ligand information

• Ligand ID: VN4
• InChI: InChI=1S/3O.V/q;;-1;
• InChIKey: ALTWGIIQPLQAAM-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [O-][V](=O)=O
• Formula: O3 V
• Name: oxido(dioxo)vanadium
• PDB chain: 4erc Chain A Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4erc New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
• Resolution: 1.15 Å
• Binding residue (original residue number in PDB): C95 A96 L97 F99 G100 R101
• Binding residue (residue number reindexed from 1): C95 A96 L97 F99 G100 R101
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.
  3.1.3.48: protein-tyrosine-phosphatase.

Gene Ontology

Molecular Function

• GO:0004721 phosphoprotein phosphatase activity
• GO:0004722 protein serine/threonine phosphatase activity
• GO:0004725 protein tyrosine phosphatase activity
• GO:0005515 protein binding
• GO:0008138 protein tyrosine/serine/threonine phosphatase activity
• GO:0016791 phosphatase activity
• GO:0017018 myosin phosphatase activity

Biological Process

• GO:0006470 protein dephosphorylation
• GO:0016311 dephosphorylation
• GO:0060271 cilium assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4erc, PDBe:4erc, PDBj:4erc
• PDBsum: 4erc
• PubMed: 23145819
• UniProt: Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 (Gene Name=DUSP23)