Structure of PDB 4er8 Chain A Binding Site BS01

Receptor Information
>4er8 Chain A (length=165) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRDRPFEI
NAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWE
HAIRNTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDW
AGDVTDFSAGERIIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4er8 The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		M1 S2 E3 Y4 R6 Y7 T17 N19 R21 S74 R78 E79 K81 K82 Q83 T85 H86 W94 Q95 R97 F98 W99 E100 H101 A102 G160 E161 R162
Binding residue
(residue number reindexed from 1)		M1 S2 E3 Y4 R6 Y7 T17 N19 R21 S74 R78 E79 K81 K82 Q83 T85 H86 W94 Q95 R97 F98 W99 E100 H101 A102 G160 E161 R162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0000405 bubble DNA binding
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0004803 transposase activity
GO:0032448 DNA hairpin binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4er8, PDBe:4er8, PDBj:4er8
PDBsum4er8
PubMed22885300
UniProtQ47152|RAYT_ECOLI REP-associated tyrosine transposase (Gene Name=rayT)

[Back to BioLiP]