Structure of PDB 4eqj Chain A Binding Site BS01

Receptor Information

>4eqj Chain A (length=200) Species: 11685 (HIV-1 M:B_ARV2/SF2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQITLWKRPLVTIRIGGQLKEALLNTGSDFTVLEEMNLPGKWKPKMIRGI
GGFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNFG
GPQITLWKRPLVTIRIGGQLKEALLNTGSDDTVLEEMNLPGKWKPKMIGG
IGGFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNF

Ligand information

>4eqj Chain G (length=6) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ETFYVD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4eqj Structural, kinetic, and thermodynamic studies of specificity designed HIV-1 protease.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	N25 G27 S28 D29 F30 R48 V82 N125 G127 S128 D129 V132 I147 G148 G149 I150 V182
Binding residue (residue number reindexed from 1)	N25 G27 S28 D29 F30 R48 V82 N126 G128 S129 D130 V133 I148 G149 G150 I151 V183

Enzymatic activity

Catalytic site (original residue number in PDB)	N125 T126 G127
Catalytic site (residue number reindexed from 1)	N126 T127 G128
Enzyme Commision number	2.7.7.- 2.7.7.49: RNA-directed DNA polymerase. 2.7.7.7: DNA-directed DNA polymerase. 3.1.-.- 3.1.13.2: exoribonuclease H. 3.1.26.13: retroviral ribonuclease H. 3.4.23.16: HIV-1 retropepsin.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4eqj, PDBe:4eqj, PDBj:4eqj
PDBsum	4eqj
PubMed	22549928
UniProt	P03369\|POL_HV1A2 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]