Structure of PDB 4ep3 Chain A Binding Site BS01

Receptor Information

>4ep3 Chain A (length=198) Species: 11685 (HIV-1 M:B_ARV2/SF2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGI
GGFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNFP
QITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIG
GFIKVRQYDQIPVEILGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNF

Ligand information

>4ep3 Chain E (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KARVLAEAM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ep3 Structural, kinetic, and thermodynamic studies of specificity designed HIV-1 protease.
Resolution	1.81 Å
Binding residue (original residue number in PDB)	R8 N25 G27 A28 D29 D30 I47 G48 I50 L76 V82 I84 N125 G127 A128 D129 D130 G148 I150 I184
Binding residue (residue number reindexed from 1)	R8 N25 G27 A28 D29 D30 I47 G48 I50 L76 V82 I84 N124 G126 A127 D128 D129 G147 I149 I183

Enzymatic activity

Catalytic site (original residue number in PDB)	N125 T126 G127
Catalytic site (residue number reindexed from 1)	N124 T125 G126
Enzyme Commision number	2.7.7.- 2.7.7.49: RNA-directed DNA polymerase. 2.7.7.7: DNA-directed DNA polymerase. 3.1.-.- 3.1.13.2: exoribonuclease H. 3.1.26.13: retroviral ribonuclease H. 3.4.23.16: HIV-1 retropepsin.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4ep3, PDBe:4ep3, PDBj:4ep3
PDBsum	4ep3
PubMed	22549928
UniProt	P03369\|POL_HV1A2 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]