Structure of PDB 4eny Chain A Binding Site BS01

Receptor Information
>4eny Chain A (length=261) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYQVGPLLGSGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGRVPMEVVLL
KKVSSFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELA
RSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLK
DTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEH
DEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVL
LPQETAEIHLH
Ligand information
Ligand IDJ19
InChIInChI=1S/C17H13ClN2O3S/c1-23-14-8-10(6-7-13(14)21)9-15-16(22)20-17(24-15)19-12-5-3-2-4-11(12)18/h2-9,21H,1H3,(H,19,20,22)/b15-9-
InChIKeyCEYSJUACBKYCKN-DHDCSXOGSA-N
SMILES
SoftwareSMILES
CACTVS 3.370COc1cc(ccc1O)C=C2SC(NC2=O)=Nc3ccccc3Cl
ACDLabs 12.01Clc3ccccc3\N=C1/S/C(C(=O)N1)=C\c2ccc(O)c(OC)c2
CACTVS 3.370COc1cc(ccc1O)/C=C/2SC(NC/2=O)=Nc3ccccc3Cl
OpenEye OEToolkits 1.7.6COc1cc(ccc1O)/C=C\2/C(=O)N/C(=N/c3ccccc3Cl)/S2
OpenEye OEToolkits 1.7.6COc1cc(ccc1O)C=C2C(=O)NC(=Nc3ccccc3Cl)S2
FormulaC17 H13 Cl N2 O3 S
Name(2Z,5Z)-2-[(2-chlorophenyl)imino]-5-(4-hydroxy-3-methoxybenzylidene)-1,3-thiazolidin-4-one
ChEMBL
DrugBank
ZINCZINC000017197783
PDB chain4eny Chain A Residue 404 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4eny Flexibility of the P-loop of Pim-1 kinase: observation of a novel conformation induced by interaction with an inhibitor
Resolution2.801 Å
Binding residue
(original residue number in PDB)		G45 S46 G50 S51 V52 A65 K67 L120 L174 D186
Binding residue
(residue number reindexed from 1)		G9 S10 G13 S14 V15 A28 K30 L76 L130 D142
Annotation score1
Binding affinityPDBbind-CN: -logKd/Ki=7.05,IC50=0.089uM
Enzymatic activity
Catalytic site (original residue number in PDB) D167 K169 N172 D186 L193 T204
Catalytic site (residue number reindexed from 1) D123 K125 N128 D142 L149 T160
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0030145 manganese ion binding
GO:0043024 ribosomal small subunit binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0016310 phosphorylation
GO:0022898 regulation of transmembrane transporter activity
GO:0043066 negative regulation of apoptotic process
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045824 negative regulation of innate immune response
GO:0045893 positive regulation of DNA-templated transcription
GO:0046777 protein autophosphorylation
GO:0050821 protein stabilization
GO:0060045 positive regulation of cardiac muscle cell proliferation
GO:0070561 vitamin D receptor signaling pathway
GO:0071346 cellular response to type II interferon
GO:0090336 positive regulation of brown fat cell differentiation
GO:1902033 regulation of hematopoietic stem cell proliferation
GO:1904263 positive regulation of TORC1 signaling
GO:1905062 positive regulation of cardioblast proliferation
GO:1990748 cellular detoxification
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4eny, PDBe:4eny, PDBj:4eny
PDBsum4eny
PubMed22869110
UniProtP11309|PIM1_HUMAN Serine/threonine-protein kinase pim-1 (Gene Name=PIM1)

[Back to BioLiP]