Structure of PDB 4enj Chain A Binding Site BS01

Receptor Information
>4enj Chain A (length=108) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHP
ETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLN
LPEYMWKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4enj Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
Resolution3.0989 Å
Binding residue
(original residue number in PDB)		Y25 G26 R39 M45 K46 W56 N61 S62 S67 R69 D70 I71
Binding residue
(residue number reindexed from 1)		Y25 G26 R39 M45 K46 W56 N61 S62 S67 R69 D70 I71
Binding affinityPDBbind-CN: Kd=0.29nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
GO:0032132 O6-alkylguanine-DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4enj, PDBe:4enj, PDBj:4enj
PDBsum4enj
PubMed22658721
UniProtQ9UTN9|ATL1_SCHPO Alkyltransferase-like protein 1 (Gene Name=atl1)

[Back to BioLiP]